The details of FoldDB ID: fd1062 |
|---|
Use the buttons at the bottom of Jsmol viewer to see different representations, ON/OFF Hydrogens, and ON/OFF rotation.
3D model is for representation purpose only. To access the experimental 3D structure kindly go to the browse structure tab and look for PDB or CCDC id.
.
.
| Identification | |
|---|---|
| FoldDB ID | fd1062 |
| One Letter code
Since there is no uniform representation for the non-natural peptides. The one letter code reported here is as it is mentioned in the original article and/or the external database. | GPSQPTYPGDDAPVEDLIRFVGRLLAYFGDTINRY |
| Source | Phage display |
| External ID | |
|---|---|
| Reaxys ID | 9992896 |
| Other information | |
|---|---|
| Application | BCL-2 binder |
| Foldamer type | α Peptide |
| Activity |
|---|
| Activity ID | Assay name | Cell line | Target Protein | Organism | Assay Category | Value | Unit | Type | Measurement object |
|---|---|---|---|---|---|---|---|---|---|
| fdact0693 | protein bindingBcl-2 protein | In Vitro (Efficacy) | 0.052 | µM | Kd (dissociation constant) | ||||
| fdact0694 | protein bindingBcl-XL protein | In Vitro (Efficacy) | 0.007 | µM | Kd (dissociation constant) |
| Citations | |||||
|---|---|---|---|---|---|
| ID | Title | Year | Authors | Journal | DOI |
Paralog-Selective Ligands for Bcl-2 Proteins | 2005 | Gemperli, Anja C., Rutledge, Stacey E., Maranda, Abby., Schepartz, Alanna | Journal of the American Chemical Society | ||
